Products
FOXO4
OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice. Appearance: Powder Purity: >99% (or refer to the Certificate of Analysis) Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs. Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years). Solubility: To be determined Shelf Life: >2 years if stored properly ...
Read more
Glow BPC 157 10mg+GHK-CU 50mg+TB500 10mg
BPC 157 10mg GHK-CU 50mg TB500 10mg Certificate ...
Read more
Follistatin
Follistatin is studied for its role in regulation of muscle growth in mice, also known as GDF-8, a TGF super family member which inhibits excessive muscle growth ...
Read more
IGF-1LR3
Items Specifications Product Name IGF-1LR3 Other Names CL281;LR3-IGF1;IDF-1 LR3;IGF LR3-1;IGF-1 LR3;IGF-1Lr3 Igtropin;LR3-IGF1 (100mcg/vial;Recombinant Human Insulin-like Growth Factor-1 LR3, rhIGF-1 CAS 946870-92-4 Molecular Formula C50H69N15O9 Appearance White power CBNumber CB6947862 Storage Dry, dark and at 0 - 4 C for short term or -20 C for long term Purity ≥99% Certificate ...
Read more
LL37
The LL-37 precursor consists of a signal peptide, cathelin conserved region, and 37 amino acid residues that, when activated, are cleaved by serine protease 3 and other proteolytic enzymes to produce bioactive LL-37, which has antibacterial, antifungal, and antiviral functions, as well as chemotactic and immunostimulatory/regulatory effects. ...
Read more
Bodybuilding oil
Bodybuilding oil for resales! Welcome to contact with us for list sharing. ...
Read more
Semaglutide raw powder
Semaglutide raw powder is a medication used to manage high blood sugar levels in people with type 2 diabetes. It belongs to a class of drugs called glucagon-like peptide-1 (GLP-1) receptor agonists, which work by stimulating the release of insulin in response to high blood sugar levels. Semaglutide raw powder is an exciting new development in the treatment of type 2 diabetes, offering many benefits over other medications. It has been shown to be highly effective in controlling blood sugar levels, reducing the risk of cardiovascular disease, and promoting weight loss. In fact, it is the first GLP-1 receptor agonist to be approved for weight management in people without diabetes. ...
Read more
Tirzepatide raw powder
Tirzepatide raw powder is a promising new drug that is currently being developed for the treatment of type 2 diabetes. It works by targeting three different hormone receptors in the body, which helps to regulate blood sugar levels and improve overall metabolic health. Moreover, tirzepatide raw powder is a testament to how far medical science has come in terms of developing innovative new treatments for chronic diseases like diabetes. It represents a significant step forward in our understanding of how to manage this condition, and gives hope to millions of people who struggle with it every day. In conclusion, tirzepatide raw powder is a truly exciting development in the field of diabetes treatment, and has the potential to make a real difference in the lives of those who need it most. While it is still in the early stages of development, the future looks bright for this innovative new drug. ...
Read moreTotal:4 page, with 37 products
Join Our Mailing List
For receiving our news and updates in your inbox directly.
Adhering to the service tenet of "Integrity, Innovation, Harmony, and Win-win", We have established a complete one-stop procurement and comprehensive solution service system.
Need Help?
Free Consultation
