FOXO4
ie84yt8348@outlook.com
Product Description
OXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Appearance: Powder
Purity: >99% (or refer to the Certificate of Analysis)
Shipping Condition: Shipped under ambient temperature as non-hazardous chemical. This product is stable enough for a few weeks during ordinary shipping and time spent in Customs.
Storage Condition: Dry, dark and at 0 - 4 C for short term (days to weeks) or -20 C for long term (months to years).
Solubility: To be determined
Shelf Life: >2 years if stored properly
“Strength builds the foundation, and excellent services reach all over the world.”
create win-win situation with customers
We have cooperated with experienced shipping forwarders for many years, they arrange the shipment. No matter by express, by air or by sea, we will track the course of the goods all the way, to make sure goods arrive at you on time and in good condition.
Related Products
Semaglutide
lt is a dual glucose-dependent insulinotropic polypeptide (GIPand glucagon-like peptide-1 (GLP-1) receptor agonist that is beingdeveloped for the treatment of type 2 diabetes. lt shows significantlybetter efficacy with regard to glucose control. ...
Retatrutide
Sequence: Tyr-{Aib}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{α-Me-Leu}-Leu-Asp-Lys-{doacod=C20-gamma-Glu-(AEEA)-Lys}-Ala-Gln-{Aib}-Ala-Phe-Ile-Glu-Tyr-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 Molecular Formula: C118H175N35O28 M ...
Cagrilintide
Cagrelinide is a a cyclic peptide composed of 38 amino acids, with a sequence containing 38 amino acids and a pair of disulfide bonds. Kaglirin can significantly reduce weight and reduce food intake. Kagrelin peptide has potential in obesity research. As a n ...
Tesamorelin 10mg
Tesamorelin, is a syntheitic peptide consiting of 44 amino acids. It is a growth-hormone-releasing hormone (GHRH) analogue researched for the treatment of HIV-associated lipodystrophy (dysfunctional, toxic fat deposition). It is also being researched for i ...
Thymosin Alpha-1 10mg
Thymosin Alpha-1 (Tα1) is a synthetic version of a naturally occurring thymic peptide, which plays a crucial role in modulating the immune system. Initially isolated from thymus gland tissue, this peptide has been extensively studied for its immunomodulato ...